How to find/build the evolutionary history of a protein from its sequence?

Question

I'd like to build the evolutionary history of a protein, given its sequence. Namely, given a FASTA entry how can I build an evolutionary tree? Here is the 5wxy protein as an example:
>5WXY:A|PDBID|CHAIN|SEQUENCE
MGHHHHHHMMKTKLPILGVLGGMGPVVTAEFLKSIYEYNPFIDKEQESPNVIVFSFPSAPDRTGSIDSGKEREFIDFIQV
NLEHLNKLADCIVIGSCTAHYALPQIPENLKDKLISLIKIADQELQEYNEPTLLLASTGTYQKKLFQEGCTTADLIISLS
ESDQKLIHEMIYKVLKRGHDPLSILRDIEALLEKYNTRSYISGSTEFHLLTKSLKLKGIDSIKAIDPLSTIAQNFSQLII
KQAQVDLVTDCHQPSNPKSP

Do I need to do some queries to Entrez in order to build the evolution tree?
I saw this paper, but I am not sure how I can use it with a single mammal's protein primary sequence.

Question given a protein name, is it possible to look for its evolutionary history or build evolution tree using other databases beside PDB on top of bioinformatics algorithms.

Devon Ryan · Answer

The general procedure is:

Find the sequence for the same (or as similar as you can find (see mentions of blast in the comments above)) gene in other species. You can use uniprot or any other large sequence database for this.
You now have a large set of sequences related to yours, which you'll need to compare. Search the methods section of your favorite paper to see how they reconstructed likely evolutionary history from this, there are a number of packages out there.

Michael · Answer

There you go, its Microcystis aeruginosa aspartate/glutamate racemase. Easy does it. If you want to know how you can do this in 15 seconds let me know.

Its one of the new features of NCBI's Blast

Go to Blast here, https://blast.ncbi.nlm.nih.gov/Blast.cgi
Enter your sequence into the box (it doesn't accept PDB codes alone)
Enter the protein database - when I first did this calculation I used SwissProt, thinking there would be alot of sequences - I then used "nr"
Under the algorithm parameters enter "50" (default is too many)
Hit "Blast"
Once the search is complete at the top of the page are the hyperlinks:
"Other reports: Search Summary [Taxonomy reports] [Distance tree of results]"
Click on "Distance tree of results"
The following page will load automatically, automatically aligning your sequences and producing, in this case a parsimony based tree, but there is also the option of a nj tree (recommended) .... here: https://www.ncbi.nlm.nih.gov/blast/treeview/treeView.cgi?request=page&blastRID=5A1ZBRU1014&queryID=lcl|Query_210080&entrezLim=&ex=&exl=&exh=&ns=50&screenWidth=1280&screenHeight=800
Click "Tool", "Download", "PDF" ...

How to find/build the evolutionary history of a protein from its sequence?

2 Answers

Add your own answers!

Related Questions

install bowtie2 from sources cannot find -ltbb

Normalize RNA seq data from multiple runs for expression analysis

Tool for rna/lna melting temperature prediction

Getting Unique Identifier List for GEO Datasets NCBI

MSA (protein) with biopython or something else?

Problem with merge data while trying to convert gene names in R

How to deal with the mismatches between gene names obtained from different sources?

Is there any value in scaffolding the output contigs of MEGAHIT assembler given a metagenomic dataset?

How to tell if our ligand-protein docking is good from AutoDock Vina’s result

Survival analysis using CoxPH – Effect of covariates

Parsing .vcf file for this information

Is there an efficient way to extract CIGAR strings for read pairs from bam files with python?

Filtering genes from cuffdiff results

Low Fraction of usable antibody reads in CiteSeq

RNA_Seq Analysis in R, propmapped function issue

Selecting part of an extracted ligand

Proper use of BWA MEM on multiplexed GBS sample

co-occurrence analysis and visualization for amplicon microbial data

How do I create a VCF file of all known pathogenic mutations in a gene of interest?

How do I write tests for a snakemake pipeline?

Ask a Question